Antibodies

Jump to Filters
View as table Download
Pannexin 3 (PANX3) (N-term) Rabbit Polyclonal Antibody
AP53158PU-N

USD 450.00

2 Weeks

Pannexin 3 (PANX3) (N-term) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 2-31 amino acids from the N-terminal region of Human PANX3
Pannexin 3 (PANX3) Rabbit Polyclonal Antibody
TA329534

USD 375.00

5 Days

Rabbit Polyclonal anti-PANX3 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PANX3 antibody: synthetic peptide directed towards the middle region of human PANX3. Synthetic peptide located within the following region: IISELDKSYNRSIRLVQHMLKIRQKSSDPYVFWNELEKARKERYFEFPLL