Rabbit Polyclonal Anti-PARP16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP16 antibody: synthetic peptide directed towards the N terminal of human PARP16. Synthetic peptide located within the following region: KRDSVLRPFPASYARGDCKDFEALLADASKLPNLKELLQSSGDNHKRAWD |
Rabbit Polyclonal Anti-PARP16 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PARP16 antibody: synthetic peptide directed towards the middle region of human PARP16. Synthetic peptide located within the following region: PKYFVVTNNQLLRVKYLLVYSQKPPKSRASSQLSWFSSHWFTVMISLYLL |
Carrier-free (BSA/glycerol-free) PARP16 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PARP16 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-PARP16 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PARP16 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), Biotinylated
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Anti-PARP16 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8), HRP conjugated
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Anti-PARP16 mouse monoclonal antibody, clone OTI2C8 (formerly 2C8)
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Anti-PARP16 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
Anti-PARP16 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2), Biotinylated
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
Anti-PARP16 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2), HRP conjugated
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
Anti-PARP16 mouse monoclonal antibody, clone OTI4E2 (formerly 4E2)
| Applications | FC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
