Rabbit Polyclonal Anti-PATZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the N terminal of human PATZ1. Synthetic peptide located within the following region: MERVNDASCGPSGCYTYQVSRHSTEMLHNLNQQRKNGGRFCDVLLRVGDE |
Rabbit Polyclonal Anti-PATZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the middle region of human PATZ1. Synthetic peptide located within the following region: SFFRSKSYLNKHIQKVHVRALGGPLGDLGPALGSPFSPQQNMSLLESFGF |
Rabbit Polyclonal Anti-PATZ1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PATZ1 antibody: synthetic peptide directed towards the N terminal of human PATZ1. Synthetic peptide located within the following region: KNGGRFCDVLLRVGDESFPAHRAVLAACSEYFESVFSAQLGDGGAADGGP |
Carrier-free (BSA/glycerol-free) PATZ1 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PATZ1 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PATZ1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PATZ1 |
PATZ1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 250-350 of human PATZ1 (NP_114440.1). |
| Modifications | Unmodified |
PATZ1 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PATZ1 mouse monoclonal antibody,clone OTI2H4, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PATZ1 mouse monoclonal antibody,clone OTI2H4, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PATZ1 mouse monoclonal antibody,clone OTI2H4
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PATZ1 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
PATZ1 mouse monoclonal antibody,clone OTI8D6, Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PATZ1 mouse monoclonal antibody,clone OTI8D6, HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PATZ1 mouse monoclonal antibody,clone OTI8D6
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
