Antibodies

Jump to Filters
View as table Download
PAR4 (PAWR) Rabbit Polyclonal Antibody
TA313091

USD 345.00

In Stock

Rabbit polyclonal Prostate Apoptosis Response Protein-4 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from human prostate apoptosis response protein-4.
PAR4 (PAWR) Rabbit Polyclonal Antibody
TA329887

USD 375.00

5 Days

Rabbit Polyclonal Anti-PAWR Antibody

Applications IHC, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-PAWR antibody: synthetic peptide directed towards the middle region of human PAWR. Synthetic peptide located within the following region: VNIPAAECLDEYEDDEAGQKERKREDAITQQNTIQNEAVNLLDPGSSYLL
PAR4 (PAWR) Rabbit Polyclonal Antibody
TA331131

USD 310.00

5 Days

Rabbit Polyclonal Anti-PAWR Antibody

Applications IHC, WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PAWR antibody: synthetic peptide directed towards the middle region of human PAWR. Synthetic peptide located within the following region: SYLLQEPPRTVSGRYKSTTSVSEEDVSSRYSRTDRSGFPRYNRDANVSGT
PAR4 (PAWR) Rabbit Polyclonal Antibody
TA322987

USD 345.00

In Stock

Anti-PAWR Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 136-278 amino acids of human PRKC, apoptosis, WT1, regulator
PAR4 (PAWR) Rabbit Polyclonal Antibody
TA322988

USD 345.00

In Stock

Anti-PAWR Rabbit Polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide peptide corresponding to a region derived from 136-278 amino acids of human PRKC, apoptosis, WT1, regulator