Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit Polyclonal anti-Pax2 antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pax2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: HIKSEQGNEYSLPALTPGLDEVKSSLSASANPELGSNVSGTQTYPVVTGR |
Rabbit Polyclonal Anti-PAX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX2 antibody: synthetic peptide directed towards the middle region of human PAX2. Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR |
Rabbit Polyclonal Anti-PAX2 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PAX2 antibody: synthetic peptide directed towards the middle region of human PAX2. Synthetic peptide located within the following region: VSSASNDPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDS |
PAX2 rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
Rabbit Polyclonal anti-PAX2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PAX2 antibody is: synthetic peptide directed towards the middle region of Human PAX2. Synthetic peptide located within the following region: DPVGSYSINGILGIPRSNGEKRKRDEDVSEGSVPNGDSQSGVDSLRKHLR |
PAX2 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PAX2 |
PAX2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is raised against a recombinant protein of PAX2 expressed in HEK293 cells |
PAX2 Rabbit Polyclonal Antibody
| Applications | ELISA, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This antibody is raised against a recombinant protein of PAX2 expressed in HEK293 cells |
Active filters
Target Symbol
- PAX2