Antibodies

Jump to Filters
View as table Download
PCBP2 Rabbit Polyclonal Antibody
TA327374

USD 275.00

3 Weeks

PCBP2 Rabbit Polyclonal Antibody

Applications ICC/IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PCBP2
PCBP2 Rabbit Polyclonal Antibody
TA345905

USD 410.00

5 Days

Rabbit Polyclonal Anti-PCBP2 Antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBP2 antibody: synthetic peptide directed towards the middle region of human PCBP2. Synthetic peptide located within the following region: VIFAGGQDRYSTGSDSASFPHTTPSMCLNPDLEGPPLEAYTIQGQYAIPQ
PCBP2 Rabbit Polyclonal Antibody
TA308051

USD 415.00

In Stock

Rabbit Polyclonal antibody to PCBP2 (poly(rC) binding protein 2)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 1 and 193 of PCBP2 (Uniprot ID#Q15366)
PCBP2 Mouse Monoclonal Antibody [Clone ID: 5F12]
AM20926PU-N

USD 480.00

2 Weeks

PCBP2 mouse monoclonal antibody, clone 5F12

Applications ELISA, IF, IHC, RNAi, WB
Reactivities Human
PCBP2 Rabbit Polyclonal Antibody
TA345904

USD 410.00

5 Days

Rabbit Polyclonal Anti-PCBP2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCBP2 antibody: synthetic peptide directed towards the N terminal of human PCBP2. Synthetic peptide located within the following region: KKGESVKKMREESGARINISEGNCPERIITLAGPTNAIFKAFAMIIDKLE
PCBP2 Rabbit Polyclonal Antibody
TA308000

USD 415.00

5 Days

Rabbit polyclonal antibody to PCBP2 (poly(rC) binding protein 2)

Applications IF, WB
Reactivities Human
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region within amino acids 302 and 365 of PCBP2 (Uniprot ID#Q15366)