Antibodies

Jump to Filters
View as table Download
PCDHA12 Rabbit Polyclonal Antibody
TA331057

USD 375.00

5 Days

Rabbit polyclonal Anti-PCDHA12 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCDHA12 antibody: synthetic peptide directed towards the N terminal of human PCDHA12. Synthetic peptide located within the following region: EVIVDRPLQVFHVDVEVKDINDNPPVFREREQKVPVSESAPLDSHFPLEG
PCDHA12 Rabbit Polyclonal Antibody
TA379681

USD 220.00

3 Weeks

PCDHA12 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 713-792 of human PCDHA12 (NP_114070.1).
Modifications Unmodified