Goat Polyclonal Antibody against PCGF3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PLLLHYRPKMDLL, from the C Terminus of the protein sequence according to NP_006306. |
Goat Polyclonal Antibody against PCGF3
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Peptide with sequence C-PLLLHYRPKMDLL, from the C Terminus of the protein sequence according to NP_006306. |
Rabbit Polyclonal Anti-PCGF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCGF3 Antibody: synthetic peptide directed towards the middle region of human PCGF3. Synthetic peptide located within the following region: EVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEEDNDYHRSD |
Rabbit Polyclonal Anti-PCGF3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PCGF3 Antibody: synthetic peptide directed towards the middle region of human PCGF3. Synthetic peptide located within the following region: FYHKLGMEVPGDIKGETCSAKQHLDSHRNGETKADDSSNKEAAEEKPEED |
PCGF3 Rabbit polyclonal Antibody
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-242 of human PCGF3 (NP_006306.2). |
Modifications | Unmodified |