Antibodies

Jump to Filters
View as table Download
PCGF5 Rabbit Polyclonal Antibody
TA330483

USD 375.00

5 Days

Rabbit Polyclonal Anti-PCGF5 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCGF5 antibody: synthetic peptide directed towards the N terminal of human PCGF5. Synthetic peptide located within the following region: ATQRKHLVKDFNPYITCYICKGYLIKPTTVTECLHTFCKTCIVQHFEDSN
PCGF5 Rabbit Polyclonal Antibody
TA379692

USD 220.00

3 Weeks

PCGF5 Rabbit polyclonal Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PCGF5.