Rabbit polyclonal PCGF6 Antibody (Center)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PCGF6 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 190-217 amino acids from the Central region of human PCGF6. |
Rabbit Polyclonal Anti-PCGF6 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PCGF6 antibody: synthetic peptide directed towards the middle region of human PCGF6. Synthetic peptide located within the following region: TQPLYNISANEGTGHFKPLEKKFVRVSGEATIGHVEKFLRRKMGLDPACQ |
PCGF6 rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PCGF6 |
PCGF6 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 161-350 of human PCGF6 (NP_001011663.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China