Antibodies

Jump to Filters
View as table Download
PCID2 Rabbit Polyclonal Antibody
TA344864

USD 475.00

5 Days

Rabbit Polyclonal Anti-RGD1307041 Antibody - middle region

Applications WB
Reactivities Rat
Conjugation Unconjugated
Immunogen The immunogen for anti-RGD1307041 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: MLFLVNQLFKIYFKINKLHLCKPLIRAIDSSNLKDDYSTAQRVTYKYYVG
PCID2 Rabbit Polyclonal Antibody
TA365197

USD 380.00

4 Weeks

PCID2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PCID2
PCID2 Rabbit Polyclonal Antibody
TA369513

USD 380.00

4 Weeks

PCID2 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Fusion protein of human PCID2