Antibodies

Jump to Filters
View as table Download
Proprotein convertase PC4 (PCSK4) Rabbit Polyclonal Antibody
TA344248

USD 475.00

5 Days

Rabbit Polyclonal Anti-PCSK4 Antibody - N-terminal region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PCSK4 antibody: synthetic peptide directed towards the N terminal of human PCSK4. Synthetic peptide located within the following region: VSSWAVQVSQGNREVERLARKFGFVNLGPIFPDGQYFHLRHRGVVQQSLT
Proprotein convertase PC4 (PCSK4) Rabbit Polyclonal Antibody
TA379705

USD 220.00

3 Weeks

PCSK4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant protein of human PCSK4.