Rabbit Polyclonal Anti-PCYOX1 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCYOX1 Antibody: synthetic peptide directed towards the C terminal of human PCYOX1. Synthetic peptide located within the following region: IFSQETLTKAQILKLFLSYDYAVKKPWLAYPHYKPPEKCPSIILHDRLYY |
PCYOX1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCYOX1 |
PCYOX1 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PCYOX1 |
Germany
Japan
United Kingdom
China
