Rabbit Polyclonal Anti-PCYT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCYT2 Antibody: synthetic peptide directed towards the C terminal of human PCYT2. Synthetic peptide located within the following region: KVDLVCHGKTEIIPDRDGSDPYQEPKRRGIFRQIDSGSNLTTDLIVQRII |
Rabbit Polyclonal Anti-PCYT2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PCYT2 Antibody: synthetic peptide directed towards the middle region of human PCYT2. Synthetic peptide located within the following region: KCPGGRNPWTGVSQFLQTSQKIIQFASGKEPQPGETVIYVAGAFDLFHIG |
Rabbit Polyclonal Anti-Pcyt2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-Pcyt2 Antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: FCVHGNDITLTVDGRDTYEEVKQAGRYRECKRTQGVSTTDLVGRMLLVTK |
PCYT2 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PCYT2 |
PCYT2 rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PCYT2 |
PCYT2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-389 of human PCYT2 (NP_002852.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
