Antibodies

Jump to Filters
View as table Download
PDIK1L Rabbit Polyclonal Antibody
TA337867

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDIK1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIK1L antibody: synthetic peptide directed towards the middle region of human PDIK1L. Synthetic peptide located within the following region: FDPRSAYYLWFVMDFCDGGDMNEYLLSRKPNRKTNTSFMLQLSSALAFLH
PDIK1L Rabbit Polyclonal Antibody
TA337868

USD 375.00

5 Days

Rabbit Polyclonal Anti-PDIK1L Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDIK1L antibody: synthetic peptide directed towards the middle region of human PDIK1L. Synthetic peptide located within the following region: TSDLEPTLKVADFGLSKVCSASGQNPEEPVSVNKCFLSTACGTDFYMAPE
PDIK1L Mouse Monoclonal Antibody [Clone ID: OTI2D11]
CF811103

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDIK1L mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDIK1L Mouse Monoclonal Antibody [Clone ID: OTI4G1]
CF811104

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PDIK1L mouse monoclonal antibody,clone OTI4G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDIK1L Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA811103

USD 379.00

In Stock

PDIK1L mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDIK1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D11]
TA811103BM

USD 420.00

4 Weeks

PDIK1L mouse monoclonal antibody,clone OTI2D11, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PDIK1L Mouse Monoclonal Antibody [Clone ID: OTI2D11]
TA811103S

USD 159.00

2 Days

PDIK1L mouse monoclonal antibody,clone OTI2D11

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDIK1L Mouse Monoclonal Antibody [Clone ID: OTI4G1]
TA811104

USD 379.00

In Stock

PDIK1L mouse monoclonal antibody,clone OTI4G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
PDIK1L Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI4G1]
TA811104AM

USD 420.00

4 Weeks

PDIK1L mouse monoclonal antibody,clone OTI4G1, Biotinylated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Biotin
PDIK1L Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI4G1]
TA811104BM

USD 420.00

4 Weeks

PDIK1L mouse monoclonal antibody,clone OTI4G1, HRP conjugated

Applications WB
Reactivities Human, Mouse, Rat
Conjugation HRP
PDIK1L Mouse Monoclonal Antibody [Clone ID: OTI4G1]
TA811104S

USD 159.00

2 Days

PDIK1L mouse monoclonal antibody,clone OTI4G1

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated