Rabbit Polyclonal Antibody against PDK3 (N-term)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PDK3 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 1-30 amino acids from the N-terminal region of human PDK3. |
Rabbit Polyclonal Anti-PDK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDK3 antibody: synthetic peptide directed towards the middle region of human PDK3. Synthetic peptide located within the following region: IYLKALSSESFERLPVFNKSAWRHYKTTPEADDWSNPSSEPRDASKYKAK |
Rabbit Polyclonal Anti-PDK3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDK3 antibody: synthetic peptide directed towards the N terminal of human PDK3. Synthetic peptide located within the following region: RPSVGLVQSWYMQSFLELLEYENKSPEDPQVLDNFLQVLIKVRNRHNDVV |
PDK3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 137-406 of human PDK3 (NP_005382.1). |
| Modifications | Unmodified |
PDK3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 137-406 of human PDK3 (NP_005382.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
