Antibodies

View as table Download

Rabbit Polyclonal Anti-PDSS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDSS1 antibody: synthetic peptide directed towards the middle region of human PDSS1. Synthetic peptide located within the following region: GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE

Rabbit Polyclonal Anti-PDSS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PDSS1 antibody: synthetic peptide directed towards the middle region of human PDSS1. Synthetic peptide located within the following region: VIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISIL

DPS1 Rabbit monoclonal Antibody

Applications IP, WB
Reactivities Human
Conjugation Unconjugated