Rabbit Polyclonal Anti-PDSS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDSS1 antibody: synthetic peptide directed towards the middle region of human PDSS1. Synthetic peptide located within the following region: GEFLQLGSKENENERFAHYLEKTFKKTASLIANSCKAVSVLGCPDPVVHE |
Rabbit Polyclonal Anti-PDSS1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PDSS1 antibody: synthetic peptide directed towards the middle region of human PDSS1. Synthetic peptide located within the following region: VIDDASSRRGKHTVNKIWGEKKAVLAGDLILSAASIALARIGNTTVISIL |
DPS1 Rabbit monoclonal Antibody
| Applications | IP, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China