Antibodies

View as table Download

Rabbit Polyclonal Anti-PDZD4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PDZD4 antibody is: synthetic peptide directed towards the C-terminal region of Human PDZD4. Synthetic peptide located within the following region: AGRRQHAEERGRRNPKTGLTLERVGPESSPYLSRRHRGQGQEGEHYHSCV

Rabbit Polyclonal Anti-Pdzd4 Antibody

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen for Anti-Pdzd4 antibody is: synthetic peptide directed towards the C-terminal region of Mouse Pdzd4. Synthetic peptide located within the following region: SEMKMGRYWSKEERKQHLIRAREQRKRREFMMQSRLECLREQQNGDSKPE