Rabbit Polyclonal Anti-PEA15 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEA15 antibody: synthetic peptide directed towards the middle region of human PEA15. Synthetic peptide located within the following region: DLLTMVVDYRTRVLKISEEDELDTKLTRIPSAKKYKDIIRQPSEEEIIKL |
Rabbit polyclonal PEA-15 (Ser104) antibody(Phospho-specific)
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized phosphopeptide derived from human PEA-15 around the phosphorylation site of serine 104(I-P-SP-A-K). |
| Modifications | Phospho-specific |
PEA15 (C-term) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide selected from the C-terminal region of human PEA-15 |
Rabbit polyclonal anti-PEA-15 antibody
| Applications | IHC |
| Reactivities | Human, MouseRat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from Internal of human PEA-15. |
Rabbit Polyclonal Anti-PEA15 Antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PEA15 |
PEA15 rabbit polyclonal antibody
| Applications | IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PEA15 |
PEA15 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-130 of human PEA15 (NP_003759.1). |
| Modifications | Unmodified |
Phospho-PEA15-S104 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S104 of human PEA15 (NP_003759.1). |
| Modifications | Phospho S104 |
Phospho-PEA15-S104 Rabbit polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S104 of human PEA15 (NP_003759.1). |
| Modifications | Phospho S104 |
Germany
Japan
United Kingdom
China
