Antibodies

Jump to Filters
View as table Download
PBP (PEBP1) Rabbit Polyclonal Antibody
TA349431

USD 380.00

In Stock

Rabbit Polyclonal Anti-PEBP1 Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PEBP1
PBP (PEBP1) Rabbit Polyclonal Antibody
TA326842

USD 275.00

3 Weeks

Rabbit anti-PEBP1 Polyclonal Antibody

Applications ICC/IF, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant protein of human PEBP1
PBP (PEBP1) Rabbit Polyclonal Antibody
TA346573

USD 410.00

5 Days

Rabbit Polyclonal Anti-PEBP1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEBP1 antibody: synthetic peptide directed towards the C terminal of human PEBP1. Synthetic peptide located within the following region: LSNRSGDHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLYEQLSGK
PBP (PEBP1) (175-187) Goat Polyclonal Antibody
AP22528PU-N

USD 440.00

2 Weeks

PBP (PEBP1) (175-187) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Chicken, Equine, Hamster, Human, Monkey, Mouse, Porcine
Immunogen Synthetic peptide from C-term of human PEBP1
PBP (PEBP1) (70-83) Goat Polyclonal Antibody
AP22542PU-N

USD 440.00

2 Weeks

PBP (PEBP1) (70-83) goat polyclonal antibody, Aff - Purified

Applications ELISA, IHC, WB
Reactivities Bovine, Canine, Human, Monkey, Porcine, Rabbit
Immunogen Synthetic peptide from an internal region of human PEBP1
PBP (PEBP1) Rabbit Polyclonal Antibody
TA326110

USD 345.00

In Stock

Rabbit polyclonal PEBP1 antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PEBP1.
PBP (PEBP1) Goat Polyclonal Antibody
TA302567

USD 375.00

5 Days

Goat Polyclonal Antibody against PEBP1

Applications WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen Peptide with sequence C-DYVPKLYEQLSGK, from the C Terminus of the protein sequence according to NP_002558.1.
PBP (PEBP1) Goat Polyclonal Antibody
TA302568

USD 375.00

5 Days

Goat Polyclonal Antibody against PEBP1 / RKIP (Internal)

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Peptide with sequence C-DPDAPSRKDPKYRE, from the internal region of the protein sequence according to NP_002558.1.
PBP (PEBP1) Mouse Monoclonal Antibody [Clone ID: OTI2D4]
CF501616

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PEBP1 mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
PEBP1 Rabbit Polyclonal Antibody
TA364548

USD 380.00

4 Weeks

PEBP1 rabbit polyclonal antibody

Applications ELISA, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Fusion protein of human PEBP1
PBP (PEBP1) Mouse Monoclonal Antibody [Clone ID: OTI2D4]
TA501616

USD 379.00

In Stock

Anti-PEBP1 (PBP) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
PBP (PEBP1) Mouse Monoclonal Antibody [Clone ID: OTI2D4]
TA501616S

USD 159.00

2 Days

Anti-PEBP1 (PBP) mouse monoclonal antibody, clone OTI2D4 (formerly 2D4)

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated