Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal PEG3 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PEG3. |
Rabbit Polyclonal Anti-PEG3 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEG3 antibody: synthetic peptide directed towards the C terminal of human PEG3. Synthetic peptide located within the following region: FGECSGYIERASTSTGGANQADEKYFKCDVCGQLFNDRLSLARHQNTHTG |
Carrier-free (BSA/glycerol-free) PEG3 mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PEG3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody,clone 1B2, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PEG3 mouse monoclonal antibody,clone 1B2, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PEG3 mouse monoclonal antibody,clone OTI1B2
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PEG3 mouse monoclonal antibody,clone 1F12, Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
PEG3 mouse monoclonal antibody,clone 1F12, HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
PEG3 mouse monoclonal antibody, clone OTI1F12 (formerly 1F12)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Active filters
Target Symbol
- PEG3