Germany
Japan
United Kingdom
China
PEX12 (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human, Mouse |
| Immunogen | KLH conjugated synthetic peptide between 137~167 amino acids from the Central region of human PEX12 |
Antibodies
View as table Download
Rabbit Polyclonal anti-Pex12 Antibody
| Applications | WB |
| Reactivities | Rat |
| Immunogen | The immunogen for Anti-Pex12 antibody is: synthetic peptide directed towards the C-terminal region of Rat Pex12. Synthetic peptide located within the following region: SVGVFFLQFLDWWYSSENQETIKSLTALPTPPPPVHLDYNSDSPLLPKMK |
PEX12 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PEX12 |
PEX12 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 290-359 of human PEX12 (NP_000277.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PEX12