Germany
Japan
United Kingdom
China
Rabbit polyclonal anti-PEX3 antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PEX3. |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PEX3 Antibody
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEX3 antibody: synthetic peptide directed towards the N terminal of human PEX3. Synthetic peptide located within the following region: KYGQKKIREIQEREAAEYIAQARRQYHFESNQRTCNMTVLSMLPTLREAL |
PEX3 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 144-373 of human PEX3 (NP_003621.1). |
| Modifications | Unmodified |
Active filters
Target Symbol
- PEX3