Germany
Japan
United Kingdom
China
Antibodies
View as table Download
Rabbit polyclonal Anti-PEX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEX5 antibody: synthetic peptide directed towards the N terminal of human PEX5. Synthetic peptide located within the following region: TATDRWYDEYHPEEDLQHTASDFVAKVDDPKLANSEFLKFVRQIGEGQVS |
Rabbit polyclonal Anti-PEX5 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PEX5 antibody: synthetic peptide directed towards the middle region of human PEX5. Synthetic peptide located within the following region: LNMQRKSRGPRGEGGAMSENIWSTLRLALSMLGQSDAYGAADARDLSTLL |
PEX5 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 364-631 of human PEX5 (NP_000310.2). |
| Modifications | Unmodified |
Anti-PEX5 mouse monoclonal antibody, clone OTI6E9 (formerly 6E9)
| Applications | FC, IF, WB |
| Reactivities | Human, Monkey, Mouse, Rat, Dog |
| Conjugation | Unconjugated |
Special Offer: Get a 15% discount on this product. Use code: "KO15".
Active filters
Target Symbol
- PEX5