Antibodies

Jump to Filters
View as table Download
PEX7 Rabbit Polyclonal Antibody
TA314328

USD 345.00

In Stock

Rabbit polyclonal anti-PEX7 antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PEX7.
PEX7 Rabbit Polyclonal Antibody
TA335139

USD 375.00

5 Days

Rabbit polyclonal Anti-PEX7 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PEX7 antibody: synthetic peptide directed towards the N terminal of human PEX7. Synthetic peptide located within the following region: MSAVCGGAARMLRTPGRHGYAAEFSPYLPGRLACATAQHYGIAGCGTLLI
PEX7 Rabbit Polyclonal Antibody
TA379821

USD 220.00

3 Weeks

PEX7 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-240 of human PEX7 (NP_000279.1).
Modifications Unmodified