Germany
Japan
United Kingdom
China
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PFKFB2 Antibody: A synthesized peptide derived from human PFKFB2 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: RNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSI |
Rabbit Polyclonal Anti-PFKFB2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pfkfb2 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: EMTYSEIEQRYPEEFALRDQEKYLYRYPGGESYQDLVQRLEPVIMELERQ |
Rabbit polyclonal anti-PFKFB2 antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from N-terminal of human PFKFB2. |
Rabbit Polyclonal Anti-PFKFB2 Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PFKFB2 |
PFKFB2 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the C terminal region of human PFKFB2 |
PFKFB2 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 446-505 of human PFKFB2 (NP_006203.2). |
| Modifications | Unmodified |
Phospho-PFKFB2-S483 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | A synthetic phosphorylated peptide around S483 of human PFKFB2 (NP_006203.2). |
| Modifications | Phospho S483 |
Active filters
Target Symbol
- PFKFB2