Antibodies

Jump to Filters

View as table

Loading...

Download Close

Download

1 - 18 of 18 results

(reset)

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA346593

USD 475.00

5 Days

Rabbit Polyclonal Anti-PFN1 Antibody

Applications	WB
Reactivities	Human, Mouse
Conjugation	Unconjugated
Immunogen	The immunogen for anti-PFN1 antibody: synthetic peptide directed towards the N terminal of human PFN1. Synthetic peptide located within the following region: AGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVL

1 / 3

2 / 3

3 / 3

Previous Next

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA326963

USD 275.00

3 Weeks

PFN1 Rabbit Polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat, Monkey
Conjugation	Unconjugated
Immunogen	Recombinant protein of human PFN1

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA309799

USD 424.00

5 Days

Rabbit Polyclonal Profilin 1 Antibody

Applications	IHC, WB
Reactivities	Bovine, Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide made to a C-terminal portion of the human protein (within residues 100-140). [Swiss-Prot# P07737]

1 / 3

2 / 3

3 / 3

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI1D5]

CF501211

USD 465.00

In Stock

Carrier-free (BSA/glycerol-free) PFN1 mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

CF501243

USD 465.00

4 Weeks

Carrier-free (BSA/glycerol-free) PFN1 mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA322681

USD 345.00

In Stock

Anti-PFN1 Rabbit Polyclonal Antibody

Applications	ELISA, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA322682

USD 345.00

In Stock

Anti-PFN1 Rabbit Polyclonal Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Fusion protein corresponding to a region derived from 2-140 amino acids of human profilin 1

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA350722

USD 345.00

In Stock

Rabbit Polyclonal Anti-PFN1 Antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PFN1

PFN1 Rabbit Polyclonal Antibody

TA371145

USD 380.00

4 Weeks

PFN1 rabbit polyclonal antibody

Applications	WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	Synthetic peptide of human PFN1

Profilin 1 (PFN1) Rabbit Polyclonal Antibody

TA384964

USD 380.00

4 Weeks

Profilin 1 Rabbit polyclonal Antibody

Applications	FC, IF, IHC, IP, WB
Reactivities	Human, Mouse, Rat
Conjugation	Unconjugated
Immunogen	A synthesized peptide derived from human Profilin1

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI1D5]

TA501211

USD 379.00

In Stock

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Profilin 1 (PFN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI1D5]

TA501211AM

USD 420.00

4 Weeks

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI1D5]

TA501211BM

USD 420.00

4 Weeks

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI1D5]

TA501211S

USD 159.00

In Stock

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI1D5 (formerly 1D5)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 10

2 / 10

3 / 10

4 / 10

5 / 10

6 / 10

7 / 10

8 / 10

9 / 10

10 / 10

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

TA501243

USD 379.00

In Stock

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Special Offer: Get a 15% discount on this product. Use code: “NEURO15".

Profilin 1 (PFN1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D2]

TA501243AM

USD 420.00

4 Weeks

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), Biotinylated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Biotin

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2D2]

TA501243BM

USD 420.00

4 Weeks

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2), HRP conjugated

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	HRP

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

Profilin 1 (PFN1) Mouse Monoclonal Antibody [Clone ID: OTI2D2]

TA501243S

USD 159.00

2 Days

Anti-PFN1 (Profilin 1) mouse monoclonal antibody, clone OTI2D2 (formerly 2D2)

Applications	FC, IF, IHC, WB
Reactivities	Human, Monkey, Mouse, Rat, Dog
Conjugation	Unconjugated

• 

1 / 9

2 / 9

3 / 9

4 / 9

5 / 9

6 / 9

7 / 9

8 / 9

9 / 9

Previous Next

1 - 18 of 18 results