Antibodies

Jump to Filters
View as table Download
PGA3 Rabbit Polyclonal Antibody
TA323322

USD 345.00

In Stock

Anti-PGA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 112-125 amino acids of Human pepsinogen 3, group I (pepsinogen A)
PGA3 Rabbit Polyclonal Antibody
TA323323

USD 345.00

In Stock

Anti-PGA3 Rabbit Polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Synthetic peptide corresponding to a region derived from 112-125 amino acids of Human pepsinogen 3, group I (pepsinogen A)
PGA3 Rabbit Polyclonal Antibody
TA338326

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGA3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGA3 antibody is: synthetic peptide directed towards the middle region of Human PGA3. Synthetic peptide located within the following region: ISDTNQIFGLSETEPGSFLYYAPFDGILGLAYPSISSSGATPVFDNIWNQ
PGA3 Rabbit Polyclonal Antibody
TA379837

USD 220.00

3 Weeks

PGA3 Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 63-180 of human PGA3 (NP_001073275.1).
Modifications Unmodified