Rabbit Polyclonal Anti-PGBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1. Synthetic peptide located within the following region: MYEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHF |
Rabbit Polyclonal Anti-PGBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the C terminal of human PGBD1. Synthetic peptide located within the following region: PQISQPSIVKVYDECKEGVAKMDQIISKYRVRIRSKKWYSILVSYMIDVA |
Rabbit Polyclonal Anti-PGBD1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PGBD1 antibody: synthetic peptide directed towards the N terminal of human PGBD1. Synthetic peptide located within the following region: YEALPGPAPENEDGLVKVKEEDPTWEQVCNSQEGSSHTQEICRLRFRHFC |
Anti-PGBD1 Rabbit Polyclonal Antibody
| Applications | ELISA, IHC |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein corresponding to a region derived from C terminal 250 amino acids of human piggyBac transposable element derived 1 |
PGBD1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 150-450 of human PGBD1 (NP_115896.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China