Antibodies

Jump to Filters
View as table Download
PGP (N-term) Rabbit Polyclonal Antibody
AP53271PU-N

USD 450.00

2 Weeks

PGP (N-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 40~70 amino acids from the N-terminal region of human PGP
PGP Rabbit Polyclonal Antibody
TA343268

USD 375.00

5 Days

Rabbit Polyclonal Anti-PGP Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PGP antibody is: synthetic peptide directed towards the C-terminal region of PGP. Synthetic peptide located within the following region: TDILLGATCGLKTILTLTGVSTLGDVKNNQESDCVSKKKMVPDFYVDSIA
Pgp Rabbit Polyclonal Antibody
TA362900

USD 360.00

5 Days

PGP Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle terminal region of mouse PGP