Antibodies

View as table Download

PHACTR3 (N-term) rabbit polyclonal antibody, Aff - Purified

Applications IHC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human PHACTR3

Rabbit Polyclonal Anti-PHACTR3 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHACTR3 antibody: synthetic peptide directed towards the C terminal of human PHACTR3. Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR

Phactr3 Antibody - middle region

Applications WB
Reactivities Mouse
Conjugation Unconjugated

PHACTR3 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3