PHACTR3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human PHACTR3 |
PHACTR3 (N-term) rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | KLH conjugated synthetic peptide between 24-54 amino acids from the N-terminal region of human PHACTR3 |
Rabbit Polyclonal Anti-PHACTR3 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PHACTR3 antibody: synthetic peptide directed towards the C terminal of human PHACTR3. Synthetic peptide located within the following region: IEMKLSKRLSQRPAVEELERRNILKQRNDQTEQEERREIKQRLTRKLNQR |
Phactr3 Antibody - middle region
Applications | WB |
Reactivities | Mouse |
Conjugation | Unconjugated |
PHACTR3 Antibody - middle region
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for Anti-PHACTR3 antibody is: synthetic peptide directed towards the middle region of Human PHAR3 |