Antibodies

View as table Download

Rabbit Polyclonal Anti-PHB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHB2 antibody: synthetic peptide directed towards the C terminal of human PHB2. Synthetic peptide located within the following region: KLRKIRAAQNISKTIATSQNRIYLTADNLVLNLQDESFTRGSDSLIKGKK

Rabbit Polyclonal Anti-PHB2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PHB2 antibody: synthetic peptide directed towards the N terminal of human PHB2. Synthetic peptide located within the following region: WFQYPIIYDIRARPRKISSPTGSKDLQMVNISLRVLSRPNAQELPSMYQR

Rabbit Polyclonal Antibody against PHB2

Applications IHC, WB
Reactivities Human (Predicted: Mouse, Rat, Bovine, Chicken)
Immunogen This REA (PHB2) antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 66-95 amino acids from the N-terminal region of human REA (PHB2).

REA (PHB2) pTyr128 rabbit polyclonal antibody

Applications IHC, WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide corresponding to amino acid residues surrounding Y128 of human PHB2.

Rabbit Polyclonal antibody to Prohibitin 2 (prohibitin 2)

Applications IF, IHC, WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen Recombinant fragment corresponding to a region within amino acids 45 and 299 of Prohibitin 2 (Uniprot ID#Q99623)

Phb2 Antibody - middle region

Applications IP, WB
Reactivities Mouse
Conjugation Unconjugated

PHB2 Antibody - middle region

Applications WB
Conjugation Unconjugated
Immunogen The immunogen is a synthetic peptide directed towards the middle region of mouse PHB2

Prohibitin 2 (PHB2) Rabbit polyclonal Antibody

Applications IHC, IP, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-299 of human Prohibitin 2 (Prohibitin 2 (PHB2)) (NP_001138303.1).
Modifications Unmodified

REA Rabbit monoclonal Antibody

Applications IF, IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated