Germany
Japan
United Kingdom
China
Rabbit anti-PHC1 Polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PHC1 |
Antibodies
View as table Download
Rabbit Polyclonal Anti-PHC1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-DKFZp686A1782 antibody is: synthetic peptide directed towards the C-terminal region of Human DKFZp686A1782. Synthetic peptide located within the following region: PLSVRAGHGERDLGNPNTAPPTPELHGINPVFLSSNPSRWSVEEVYEFIA |
PHC1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PHC1 |
Active filters
Target Symbol
- PHC1