Rabbit Polyclonal Anti-PHF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF19 antibody: synthetic peptide directed towards the C terminal of human PHF19. Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET |
Rabbit Polyclonal Anti-PHF19 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF19 antibody: synthetic peptide directed towards the C terminal of human PHF19. Synthetic peptide located within the following region: RRCIFALAVRVSLPSSPVPASPASSSGADQRLPSQSLSSKQKGHTWALET |
PHF19 Rabbit polyclonal Antibody
| Applications | IF, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-207 of human PHF19 (NP_001009936.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
