Rabbit Polyclonal Anti-PHF21A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHF21A antibody: synthetic peptide directed towards the N terminal of human PHF21A. Synthetic peptide located within the following region: MELQTLQEALKVEIQVHQKLVAQMKQDPQNADLKKQLHELQAKITALSEK |
PHF21A (Center) rabbit polyclonal antibody, Aff - Purified
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide between 435-464 amino acids from the Central region of human PHF21A |
Rabbit Polyclonal Anti-PHF21A Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for Anti-PHF21A Antibody: synthetic peptide directed towards the middle region of human PHF21A. Synthetic peptide located within the following region: LSKPSLEKQTVKSHTETDEKQTESRTITPPAAPKPKREENPQKLAFMVSL |
PHF21A rabbit polyclonal antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PHF21A |
PHF21A Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 461-680 of human PHF21A (NP_001095272.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
