Rabbit Polyclonal Anti-PHLDA2 Antibody - middle region
| Applications | IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PHLDA2 antibody: synthetic peptide directed towards the middle region of human PHLDA2. Synthetic peptide located within the following region: QNRRALQDFRSRQERTAPAAPAEDAVAAAAAAPSEPSEPSRPSPQPKPRT |
Rabbit polyclonal anti-PHLA2 antibody
| Applications | IHC |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The antiserum was produced against synthesized peptide derived from internal of human PHLA2. |
PHLDA2 Antibody - N-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
PHLDA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human PHLDA2 (NP_003302.1). |
| Modifications | Unmodified |
PHLDA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-152 of human PHLDA2 (NP_003302.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China
