Rabbit Polyclonal Anti-PIH1D1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIH1D1 antibody is: synthetic peptide directed towards the C-terminal region of Human PIH1D1. Synthetic peptide located within the following region: GLSLEIGENRLVMGGPQQLYHLDAYIPLQINSHESKAAFHRKRKQLMVAM |
PIH1D1 Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen is a synthetic peptide directed towards the middle region of human PIH1D1 |
PIH1D1 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-290 of human PIH1D1 (NP_060386.1). |
| Modifications | Unmodified |
Germany
Japan
United Kingdom
China