Antibodies

View as table Download

PILRB goat polyclonal antibody, Purified

Applications ELISA, IHC
Reactivities Human
Immunogen PILRB antibody was raised against Synthetic peptide

Rabbit Polyclonal Anti-PILRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA

Rabbit Polyclonal Anti-PILRB Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PILRB

Rabbit Polyclonal Anti-PILRB Antibody

Applications IHC
Reactivities Human
Conjugation Unconjugated
Immunogen Fusion protein of human PILRB