PILRB goat polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | PILRB antibody was raised against Synthetic peptide |
PILRB goat polyclonal antibody, Purified
Applications | ELISA, IHC |
Reactivities | Human |
Immunogen | PILRB antibody was raised against Synthetic peptide |
Rabbit Polyclonal Anti-PILRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PILRB antibody: synthetic peptide directed towards the middle region of human PILRB. Synthetic peptide located within the following region: KLTITQAVTTTTTWRPSSTTTIAGLRVTESKGHSESWHLSLDTAIRVALA |
Rabbit Polyclonal Anti-PILRB Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PILRB |
Rabbit Polyclonal Anti-PILRB Antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Fusion protein of human PILRB |