Rabbit polyclonal PIP5KL1 Antibody (N-term)
| Applications | IF, IHC, WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | This PIP5KL1 antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide between 57-86 amino acids from the N-terminal region of human PIP5KL1. |
Rabbit Polyclonal Anti-PIP5KL1 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PIP5KL1 antibody: synthetic peptide directed towards the middle region of human PIP5KL1. Synthetic peptide located within the following region: VLDYSLLIAFQRLHEDERGPGSSLIFRTARSVQGAQSPEESRAQNRRLLP |
PIP5KL1 Antibody - C-terminal region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
