Rabbit Polyclonal Anti-PISD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: WKHGFFSLTAVGATNVGSIRIYFDRDLHTNSPRHSKGSYNDFSFVTHTNR |
Rabbit Polyclonal Anti-PISD Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PISD antibody is: synthetic peptide directed towards the C-terminal region of Human PISD. Synthetic peptide located within the following region: MCTEDLPFPPAASCDSFKNQLVTREGNELYHCVIYLAPGDYHCFHSPTDW |
Carrier-free (BSA/glycerol-free) PISD mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PISD mouse monoclonal antibody, clone OTI5G2 (formerly 5G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PISD mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PISD rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Fusion protein of human PISD |
PISD Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-375 of human PISD (NP_055153.1). |
| Modifications | Unmodified |
USD 420.00
4 Weeks
PISD mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PISD mouse monoclonal antibody, clone OTI5D8 (formerly 5D8), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PISD mouse monoclonal antibody, clone OTI5D8 (formerly 5D8), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PISD mouse monoclonal antibody, clone OTI5D8 (formerly 5D8)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PISD mouse monoclonal antibody, clone OTI5G2 (formerly 5G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PISD mouse monoclonal antibody, clone OTI5G2 (formerly 5G2), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PISD mouse monoclonal antibody, clone OTI5G2 (formerly 5G2), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PISD mouse monoclonal antibody, clone OTI5G2 (formerly 5G2)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PISD mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
PISD mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), Biotinylated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Biotin |
PISD mouse monoclonal antibody, clone OTI2C1 (formerly 2C1), HRP conjugated
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | HRP |
PISD mouse monoclonal antibody, clone OTI2C1 (formerly 2C1)
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China
