Antibodies

Jump to Filters
View as table Download
PLA1A Rabbit Polyclonal Antibody
TA319922

USD 430.00

5 Days

Rabbit Polyclonal PLA1A Antibody

Applications IF, WB
Reactivities Human, Rat
Conjugation Unconjugated
Immunogen PLA1A antibody was raised against a 17 amino acid synthetic peptide near the carboxy terminus of human PLA1A.
PLA1A (Center) Rabbit Polyclonal Antibody
AP53321PU-N

USD 450.00

2 Weeks

PLA1A (Center) rabbit polyclonal antibody, Aff - Purified

Applications WB
Reactivities Human, Mouse
Immunogen KLH conjugated synthetic peptide between 336~366 amino acids from the Central region of human PLA1A
PLA1A Rabbit Polyclonal Antibody
TA339332

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLA1A Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLA1A antibody: synthetic peptide directed towards the middle region of human PLA1A. Synthetic peptide located within the following region: TDTDNLGIRIPVGHVDYFVNGGQDQPGCPTFFYAGYSYLICDHMRAVHLY