Rabbit Polyclonal Anti-PLAT Antibody - middle region
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLAT antibody: synthetic peptide directed towards the middle region of human PLAT. Synthetic peptide located within the following region: TVILGRTYRVVPGEEEQKFEVEKYIVHKEFDDDTYDNDIALLQLKSDSSR |
Rabbit anti-PLAT Polyclonal Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Recombinant protein of human PLAT |
PLAT (Center) rabbit polyclonal antibody
| Applications | WB |
| Reactivities | Human |
| Immunogen | KLH conjugated synthetic peptide selected from the Center region of human TPA |
Anti-PLAT Rabbit Polyclonal Antibody
| Applications | IHC, WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide corresponding to a region derived from 255-267 amino acids of human plasminogen activator, tissue |
Germany
Japan
United Kingdom
China
