Germany
Japan
United Kingdom
China
Perilipin-1 (PLIN1) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
| Immunogen | Duplicated N-terminus of Perilipin, aa 1-20 (cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Antibodies
View as table DownloadPerilipin-1 (PLIN1) mouse monoclonal antibody, clone PERI112.17, Supernatant
| Applications | IF, IHC, WB |
| Reactivities | Bovine, Human, Mouse, Rat |
Rabbit polyclonal anti-Perilipin A antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide surrounding amino acid 510 of mouse Perilipin A. |
Rabbit Polyclonal Perilipin Antibody
| Applications | WB |
| Reactivities | Bovine, Human, Mouse, Porcine, Rat, Sheep |
| Conjugation | Unconjugated |
| Immunogen | A synthetic peptide made to a region between residues 450-522 (C-terminus) of the human perilipin protein. [Swiss-Prot# O60240] |
Rabbit Polyclonal Anti-PLIN Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-PLIN antibody: synthetic peptide directed towards the N terminal of human PLIN. Synthetic peptide located within the following region: STQFTAANELACRGLDHLEEKIPALQYPPEKIASELKDTISTRLRSARNS |
Perilipin-1 (PLIN1) (C-term) guinea pig polyclonal antibody, Serum
| Applications | IHC, WB |
| Reactivities | Bovine, Human |
| Immunogen | C-terminus of Perilipin-1 (hCTA/B; aa 507-519; cf. Greenberg et al. 1992, JBC 266, 11341-11346) |
Goat Polyclonal Antibody against PLIN (C-terminal)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | Peptide with sequence C-EPILGRAQYSQLRKK, from the C Terminus of the protein sequence according to NP_002657.2. |
Rabbit Polyclonal Anti-PLIN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLIN1 |
Rabbit Polyclonal Anti-PLIN1 Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Synthetic peptide of human PLIN1 |
Active filters
Target Symbol
- PLIN1