LPPR2 (PLPPR2) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the LPPRP2 protein |
LPPR2 (PLPPR2) rabbit polyclonal antibody, Aff - Purified
Applications | ELISA, WB |
Reactivities | Human |
Immunogen | Synthetic peptide derived from the LPPRP2 protein |
Rabbit Polyclonal Anti-LPPR2 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-LPPR2 antibody: synthetic peptide directed towards the middle region of human LPPR2. Synthetic peptide located within the following region: NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA |