Antibodies

View as table Download

LPPR2 (PLPPR2) rabbit polyclonal antibody, Aff - Purified

Applications ELISA, WB
Reactivities Human
Immunogen Synthetic peptide derived from the LPPRP2 protein

Rabbit Polyclonal Anti-LPPR2 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-LPPR2 antibody: synthetic peptide directed towards the middle region of human LPPR2. Synthetic peptide located within the following region: NYTALGCLPPSPDRPGPDRFVTDQGACAGSPSLVAAARRAFPCKDAALCA