Antibodies

Jump to Filters
View as table Download
PLS1 Rabbit Polyclonal Antibody
TA337685

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLS1 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PLS1 antibody: synthetic peptide directed towards the N terminal of human PLS1. Synthetic peptide located within the following region: ISFEEFVSLMQELKSKDISKTFRKIINKREGITAIGGTSTISSEGTQHSY
PLS1 Rabbit Polyclonal Antibody
TA380059

USD 220.00

3 Weeks

PLS1 Rabbit polyclonal Antibody

Applications IHC, WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-110 of human PLS1 (NP_001165783.1).
Modifications Unmodified