Antibodies

Jump to Filters
View as table Download
PLSCR4 Rabbit Polyclonal Antibody
TA331285

USD 375.00

5 Days

Rabbit Polyclonal Anti-PLSCR4 Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PLSCR4 antibody is: synthetic peptide directed towards the C-terminal region of Human PLSCR4. Synthetic peptide located within the following region: HWNLCRAVYSIQNEKKENVMRVRGPCSTYGCGSDSVFEVKSLDGISNIGS
PLSCR4 Rabbit Polyclonal Antibody
TA380063

USD 220.00

3 Weeks

PLSCR4 Rabbit polyclonal Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 1-270 of human PLSCR4 (NP_065086.2).
Modifications Unmodified