PMP22 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PMP22 |
PMP22 rabbit polyclonal antibody
Applications | IHC |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PMP22 |
PMP22 rabbit polyclonal antibody, Aff - Purified
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
Rabbit Polyclonal Anti-PMP22 Antibody
Applications | WB |
Reactivities | Human |
Conjugation | Unconjugated |
Immunogen | The immunogen for anti-PMP22 antibody is: synthetic peptide directed towards the N-terminal region of PMP22. Synthetic peptide located within the following region: QWIVGNGHATDLWQNCSTSSSGNVHHCFSSSPNEWLQSVQATMILSIIFS |
Mouse Monoclonal PMP22 Antibody (Hu1)
Applications | IHC |
Reactivities | Human, Primate |
Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) PMP22 mouse monoclonal antibody,clone OTI5D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
PMP22 rabbit polyclonal antibody
Applications | IHC, WB |
Reactivities | Human, Mouse |
Conjugation | Unconjugated |
Immunogen | Synthetic peptide of human PMP22 |
PMP22 mouse monoclonal antibody,clone OTI5D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |
USD 420.00
4 Weeks
PMP22 mouse monoclonal antibody,clone OTI5D1, Biotinylated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Biotin |
PMP22 mouse monoclonal antibody,clone OTI5D1, HRP conjugated
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | HRP |
PMP22 mouse monoclonal antibody,clone OTI5D1
Applications | IHC, WB |
Reactivities | Human, Mouse, Rat |
Conjugation | Unconjugated |