Antibodies

Jump to Filters
View as table Download
PMPCA (C-term) Rabbit Polyclonal Antibody
AP53362PU-N

USD 450.00

2 Weeks

PMPCA (C-term) rabbit polyclonal antibody, Aff - Purified

Applications FC, WB
Reactivities Human
Immunogen KLH conjugated synthetic peptide between 461-490 amino acids from the C-terminal region of human PMPCA
PMPCA Rabbit Polyclonal Antibody
TA331965

USD 375.00

5 Days

Rabbit Polyclonal Anti-PMPCA Antibody

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for Anti-PMPCA Antibody is: synthetic peptide directed towards the C-terminal region of Human PMPCA. Synthetic peptide located within the following region: IRNVKPEDVKRVASKMLRGKPAVAALGDLTDLPTYEHIQTALSSKDGRLP
PMPCA Rabbit Polyclonal Antibody
TA380084

USD 220.00

3 Weeks

PMPCA Rabbit polyclonal Antibody

Applications WB
Reactivities Human, Mouse, Rat
Conjugation Unconjugated
Immunogen Recombinant fusion protein containing a sequence corresponding to amino acids 456-525 of human PMPCA (NP_055975.1).
Modifications Unmodified