Antibodies

Jump to Filters
View as table Download
PNPLA8 Rabbit Polyclonal Antibody
TA345108

USD 475.00

5 Days

Rabbit Polyclonal Anti-PNPLA8 Antibody - middle region

Applications WB
Reactivities Human
Conjugation Unconjugated
Immunogen The immunogen for anti-PNPLA8 antibody: synthetic peptide directed towards the middle region of human PNPLA8. Synthetic peptide located within the following region: IDNRTRALVQALRRTTDPKLCITRVEELTFHLLEFPEGKGVAVKERIIPY
PNPLA8 Rabbit Polyclonal Antibody
TA315422

USD 345.00

In Stock

Rabbit polyclonal anti-PNPLA8 antibody

Applications WB
Reactivities Human, Mouse
Conjugation Unconjugated
Immunogen The antiserum was produced against synthesized peptide derived from internal of human PNPLA8.