Rabbit Polyclonal Anti-POLA2 Antibody
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-POLA2 antibody is: synthetic peptide directed towards the N-terminal region of Human POLA2. Synthetic peptide located within the following region: VGLTSEILNSFEHEFLSKRLSKARHSTCKDSGHAGARDIVSIQELIEVEE |
Rabbit Polyclonal Anti-Pola2 Antibody
| Applications | WB |
| Reactivities | Mouse |
| Conjugation | Unconjugated |
| Immunogen | The immunogen for anti-Pola2 antibody is: synthetic peptide directed towards the middle region of MOUSE Pola2. Synthetic peptide located within the following region: FSPSATPSQKYTSRTNRGEVVTTFGSAQGLSWSGRGGSGSVSLKVVGDPE |
Carrier-free (BSA/glycerol-free) POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Carrier-free (BSA/glycerol-free) POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
POLA2 Rabbit polyclonal Antibody
| Applications | WB |
| Reactivities | Human, Mouse, Rat |
| Conjugation | Unconjugated |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-250 of human POLA2 (NP_002680.2). |
| Modifications | Unmodified |
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
POLA2 mouse monoclonal antibody, clone OTI3F2 (formerly 3F2)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
POLA2 mouse monoclonal antibody, clone OTI3G7 (formerly 3G7)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
USD 420.00
4 Weeks
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), Biotinylated
| Applications | WB |
| Reactivities | Human |
| Conjugation | Biotin |
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4), HRP conjugated
| Applications | WB |
| Reactivities | Human |
| Conjugation | HRP |
POLA2 mouse monoclonal antibody, clone OTI2B4 (formerly 2B4)
| Applications | WB |
| Reactivities | Human |
| Conjugation | Unconjugated |
Germany
Japan
United Kingdom
China